Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) has additional insertions and/or extensions that are not grouped together |
Protein Leucine-binding protein [53843] (1 species) |
Species Escherichia coli [TaxId:562] [53844] (4 PDB entries) |
Domain d1uskb_: 1usk B: [99868] complexed with leu |
PDB Entry: 1usk (more details), 2 Å
SCOPe Domain Sequences for d1uskb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uskb_ c.93.1.1 (B:) Leucine-binding protein {Escherichia coli [TaxId: 562]} ddikvavvgamsgpiaqwgdmefngarqaikdinakggikgdklvgveyddacdpkqava vankivndgikyvighlcssstqpasdiyedegilmispgatnpeltqrgyqhimrtagl dssqgptaakyiletvkpqriaiihdkqqygeglarsvqdglkaananvvffdgitagek dfsaliarlkkenidfvyyggyypemgqmlrqarsvglktqfmgpegvgnaslsniagda aegmlvtmpkrydqdpanqgivdalkadkkdpsgpyvwityaavqslatalertgsdepl alvkdlkangantvigplnwdekgdlkgfdfgvfqwhadgsstkak
Timeline for d1uskb_: