Lineage for d1us5a_ (1us5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914629Protein Putative GluR0 ligand binding core [102696] (1 species)
  7. 2914630Species Thermus thermophilus [TaxId:274] [102697] (2 PDB entries)
  8. 2914631Domain d1us5a_: 1us5 A: [99856]
    complexed with edo, glu
    has additional insertions and/or extensions that are not grouped together

Details for d1us5a_

PDB Entry: 1us5 (more details), 1.5 Å

PDB Description: putative glur0 ligand binding core with l-glutamate
PDB Compounds: (A:) putative glur0 ligand binding core

SCOPe Domain Sequences for d1us5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1us5a_ c.94.1.1 (A:) Putative GluR0 ligand binding core {Thermus thermophilus [TaxId: 274]}
aqefitigsgsttgvyfpvatgiaklvndanvgiranarstggsvaninainagefemal
aqndiayyayqgccipafegkpvktiralaalypevvhvvarkdagirtvadlkgkrvvv
gdvgsgteqnarqileaygltfddlgqairvsasqgiqlmqdkradalfytvglgasaiq
qlalttpialvavdlnriqaiakkypfyvgfnipggtykgvdvttptvavqamliaserl
seetvykfmkavfgnleafkkihpnlerffglekavkglpiplhpgaerfykeagvlk

SCOPe Domain Coordinates for d1us5a_:

Click to download the PDB-style file with coordinates for d1us5a_.
(The format of our PDB-style files is described here.)

Timeline for d1us5a_: