SCOPe 2.06: Domain d1us4a_: 1us4 A:

Lineage for d1us4a_ (1us4 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein Putative GluR0 ligand binding core [102696] (1 species)

7. Species Thermus thermophilus [TaxId:274] [102697] (2 PDB entries)

8. Domain d1us4a_: 1us4 A: [99855]
   complexed with edo, glu

Details for d1us4a_

PDB Entry: 1us4, 1.75 Å

PDB Description: putative glur0 ligand binding core with l-glutamate

PDB Compounds: (A:) putative glur0 ligand binding core

SCOPe Domain Sequences for d1us4a_:

Sequence; same for both SEQRES and ATOM records:

>d1us4a_ c.94.1.1 (A:) Putative GluR0 ligand binding core {Thermus thermophilus [TaxId: 274]}
aqefitigsgsttgvyfpvatgiaklvndanvgiranarstggsvaninainagefemal
aqndiayyayqgccipafegkpvktiralaalypevvhvvarkdagirtvadlkgkrvvv
gdvgsgteqnarqileaygltfddlgqairvsasqgiqlmqdkradalfytvglgasaiq
qlalttpialvavdlnriqaiakkypfyvgfnipggtykgvdvttptvavqamliaserl
seetvykfmkavfgnleafkkihpnlerffglekavkglpiplhpgaerfykeagvlk

Timeline for d1us4a_:

• d1us4a_ first appeared in SCOP 1.67
  
• d1us4a_ appears in SCOPe 2.05
  
• d1us4a_ appears in SCOPe 2.07
  
• d1us4a_ appears in the current release, SCOPe 2.08