Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) |
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
Protein Chitinase B [54560] (1 species) |
Species Serratia marcescens [TaxId:615] [54561] (18 PDB entries) |
Domain d1ur9a3: 1ur9 A:292-379 [99821] Other proteins in same PDB: d1ur9a1, d1ur9a2, d1ur9b1, d1ur9b2 complexed with gdl, gol, nag, phj, so4 |
PDB Entry: 1ur9 (more details), 1.8 Å
SCOPe Domain Sequences for d1ur9a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ur9a3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens [TaxId: 615]} ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg nygyqrlwndktktpylyhaqnglfvty
Timeline for d1ur9a3: