SCOP 1.75: Domain d1ur8a3: 1ur8 A:292-379

Lineage for d1ur8a3 (1ur8 A:292-379)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Chitinase B [54560] (1 species)

7. Species Serratia marcescens [TaxId:615] [54561] (14 PDB entries)

8. Domain d1ur8a3: 1ur8 A:292-379 [99815]
   Other proteins in same PDB: d1ur8a1, d1ur8a2, d1ur8b1, d1ur8b2

Details for d1ur8a3

PDB Entry: 1ur8, 1.9 Å

PDB Description: interactions of a family 18 chitinase with the designed inhibitor hm508, and its degradation product, chitobiono-delta-lactone

PDB Compounds: (A:) chitinase b

SCOP Domain Sequences for d1ur8a3:

Sequence; same for both SEQRES and ATOM records:

>d1ur8a3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens [TaxId: 615]}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

Timeline for d1ur8a3:

• d1ur8a3 first appeared in SCOP 1.67
  
• d1ur8a3 appears in SCOP 1.73
  
• d1ur8a3 appears in SCOPe 2.01
  
• d1ur8a3 appears in the current release, SCOPe 2.08