SCOPe 2.04: Domain d1ur6b_: 1ur6 B:

Lineage for d1ur6b_ (1ur6 B:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)

6. Protein Not-4 N-terminal RING finger domain [64579] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64580] (2 PDB entries)

8. Domain d1ur6b_: 1ur6 B: [99812]
   Other proteins in same PDB: d1ur6a_
   complexed with zn

Details for d1ur6b_

PDB Entry: 1ur6

PDB Description: nmr based structural model of the ubch5b-cnot4 complex

PDB Compounds: (B:) potential transcriptional repressor not4hp

SCOPe Domain Sequences for d1ur6b_:

Sequence; same for both SEQRES and ATOM records:

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}
vecplcmepleiddinffpctcgyqicrfcwhrirtdenglcpacrkpyped

Timeline for d1ur6b_:

• d1ur6b_ first appeared in SCOP 1.67
  
• d1ur6b_ appears in SCOPe 2.03
  
• d1ur6b_ appears in SCOPe 2.05
  
• d1ur6b_ appears in the current release, SCOPe 2.08