Lineage for d1ur5c2 (1ur5 C:144-309)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 420654Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 420655Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 420656Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 420744Protein Malate dehydrogenase [56329] (11 species)
  7. 420774Species Chloroflexus aurantiacus [69840] (2 PDB entries)
  8. 420776Domain d1ur5c2: 1ur5 C:144-309 [99810]
    Other proteins in same PDB: d1ur5a1, d1ur5c1
    complexed with cd, cl, na, nad; mutant

Details for d1ur5c2

PDB Entry: 1ur5 (more details), 1.75 Å

PDB Description: stabilization of a tetrameric malate dehydrogenase by introduction of a disulfide bridge at the dimer/dimer interface

SCOP Domain Sequences for d1ur5c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ur5c2 d.162.1.1 (C:144-309) Malate dehydrogenase {Chloroflexus aurantiacus}
agvldaaryrtfiameagvsvedvqamlmgghgdemvplprfscisgipvsefiapdrla
qivertrkgggeivnllktgsayyapaaataqmveavlkdkkrvmpvaayltgqyglndi
yfgvpvilgaggvekilelplneeemallnasakavratldtlksl

SCOP Domain Coordinates for d1ur5c2:

Click to download the PDB-style file with coordinates for d1ur5c2.
(The format of our PDB-style files is described here.)

Timeline for d1ur5c2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ur5c1