Lineage for d1ur5c1 (1ur5 C:2-143)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 388231Family c.2.1.5: LDH N-terminal domain-like [51848] (7 proteins)
  6. 388323Protein Malate dehydrogenase [51849] (11 species)
  7. 388353Species Chloroflexus aurantiacus [69415] (2 PDB entries)
  8. 388355Domain d1ur5c1: 1ur5 C:2-143 [99809]
    Other proteins in same PDB: d1ur5a2, d1ur5c2
    complexed with cd, cl, na, nad; mutant

Details for d1ur5c1

PDB Entry: 1ur5 (more details), 1.75 Å

PDB Description: stabilization of a tetrameric malate dehydrogenase by introduction of a disulfide bridge at the dimer/dimer interface

SCOP Domain Sequences for d1ur5c1:

Sequence, based on SEQRES records: (download)

>d1ur5c1 c.2.1.5 (C:2-143) Malate dehydrogenase {Chloroflexus aurantiacus}
rkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvtg
tnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnnp
ldamtylaaevsgfpkervigq

Sequence, based on observed residues (ATOM records): (download)

>d1ur5c1 c.2.1.5 (C:2-143) Malate dehydrogenase {Chloroflexus aurantiacus}
rkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvtg
tnnyadtansdvivvtsgaredlikvnaditracisqaaplspnaviimvnnpldamtyl
aaevsgfpkervigq

SCOP Domain Coordinates for d1ur5c1:

Click to download the PDB-style file with coordinates for d1ur5c1.
(The format of our PDB-style files is described here.)

Timeline for d1ur5c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ur5c2