Lineage for d1upoa_ (1upo A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372425Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 373072Superfamily b.34.14: PAZ domain [101690] (1 family) (S)
  5. 373073Family b.34.14.1: PAZ domain [101691] (2 proteins)
  6. 373077Protein Argonaute 2 [101692] (1 species)
  7. 373078Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101693] (2 PDB entries)
  8. 373079Domain d1upoa_: 1upo A: [99766]

Details for d1upoa_

PDB Entry: 1upo (more details)

PDB Description: structure and nucleic acid binding of the drosophila argonaute2 paz domain

SCOP Domain Sequences for d1upoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upoa_ b.34.14.1 (A:) Argonaute 2 {Fruit fly (Drosophila melanogaster)}
ampmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvngls
rapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsiee

SCOP Domain Coordinates for d1upoa_:

Click to download the PDB-style file with coordinates for d1upoa_.
(The format of our PDB-style files is described here.)

Timeline for d1upoa_:

  • d1upoa_ is new in SCOP 1.67
  • d1upoa_ became obsolete in SCOP 1.69