Lineage for d1upcd2 (1upc D:12-197)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1844143Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1844144Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1844145Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
    automatically mapped to Pfam PF02776
  6. 1844193Protein Carboxyethylarginine synthase [102330] (1 species)
  7. 1844194Species Streptomyces clavuligerus [TaxId:1901] [102331] (6 PDB entries)
  8. 1844218Domain d1upcd2: 1upc D:12-197 [99748]
    Other proteins in same PDB: d1upca1, d1upca3, d1upcb1, d1upcb3, d1upcc1, d1upcc3, d1upcd1, d1upcd3, d1upce1, d1upce3, d1upcf1, d1upcf3
    complexed with mg, so4, tpp

Details for d1upcd2

PDB Entry: 1upc (more details), 2.45 Å

PDB Description: carboxyethylarginine synthase from streptomyces clavuligerus
PDB Compounds: (D:) carboxyethylarginine synthase

SCOPe Domain Sequences for d1upcd2:

Sequence, based on SEQRES records: (download)

>d1upcd2 c.36.1.5 (D:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidttvpnppantp
akpvgv

Sequence, based on observed residues (ATOM records): (download)

>d1upcd2 c.36.1.5 (D:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidtpnppantpak
pvgv

SCOPe Domain Coordinates for d1upcd2:

Click to download the PDB-style file with coordinates for d1upcd2.
(The format of our PDB-style files is described here.)

Timeline for d1upcd2: