![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
![]() | Protein Carboxyethylarginine synthase [102335] (1 species) |
![]() | Species Streptomyces clavuligerus [TaxId:1901] [102336] (3 PDB entries) |
![]() | Domain d1upba3: 1upb A:375-572 [99728] Other proteins in same PDB: d1upba1, d1upba2, d1upbb1, d1upbb2, d1upbc1, d1upbc2, d1upbd1, d1upbd2 |
PDB Entry: 1upb (more details), 2.35 Å
SCOP Domain Sequences for d1upba3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1upba3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} petyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfltsag cssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndtng lielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrpfl ievpvnydfqpggfgals
Timeline for d1upba3: