Lineage for d1upba1 (1upb A:198-374)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843167Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 1843168Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 1843195Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 1843301Protein Carboxyethylarginine synthase [102290] (1 species)
  7. 1843302Species Streptomyces clavuligerus [TaxId:1901] [102291] (6 PDB entries)
  8. 1843315Domain d1upba1: 1upb A:198-374 [99726]
    Other proteins in same PDB: d1upba2, d1upba3, d1upbb2, d1upbb3, d1upbc2, d1upbc3, d1upbd2, d1upbd3
    complexed with mg, so4, tpp

Details for d1upba1

PDB Entry: 1upb (more details), 2.35 Å

PDB Description: carboxyethylarginine synthase from streptomyces clavuligerus
PDB Compounds: (A:) carboxyethylarginine synthase

SCOPe Domain Sequences for d1upba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upba1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
vadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyiakgvl
pvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiekktvr
isptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaeflad

SCOPe Domain Coordinates for d1upba1:

Click to download the PDB-style file with coordinates for d1upba1.
(The format of our PDB-style files is described here.)

Timeline for d1upba1: