Lineage for d1unsa2 (1uns A:121-236)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717870Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 717871Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)
  6. 717907Protein Staphylococcal enterotoxin C2, SEC2 [54338] (1 species)
  7. 717908Species Staphylococcus aureus [TaxId:1280] [54339] (8 PDB entries)
  8. 717910Domain d1unsa2: 1uns A:121-236 [99683]
    Other proteins in same PDB: d1unsa1
    complexed with zn

Details for d1unsa2

PDB Entry: 1uns (more details), 2 Å

PDB Description: identification of a secondary zinc-binding site in staphylococcal enterotoxin c2: implications for superantigen recognition
PDB Compounds: (A:) enterotoxin type c-2

SCOP Domain Sequences for d1unsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1unsa2 d.15.6.1 (A:121-236) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus [TaxId: 1280]}
nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhltt

SCOP Domain Coordinates for d1unsa2:

Click to download the PDB-style file with coordinates for d1unsa2.
(The format of our PDB-style files is described here.)

Timeline for d1unsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1unsa1