Lineage for d1unnb3 (1unn B:245-366)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418559Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 418560Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 418561Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
    duplication: consists of three domains of this fold
  6. 418562Protein DNA polymerase III, beta subunit [55981] (1 species)
  7. 418563Species Escherichia coli [TaxId:562] [55982] (5 PDB entries)
  8. 418575Domain d1unnb3: 1unn B:245-366 [99679]
    Other proteins in same PDB: d1unnc_, d1unnd_
    complexed with so4

Details for d1unnb3

PDB Entry: 1unn (more details), 1.9 Å

PDB Description: complex of beta-clamp processivity factor and little finger domain of poliv

SCOP Domain Sequences for d1unnb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1unnb3 d.131.1.1 (B:245-366) DNA polymerase III, beta subunit {Escherichia coli}
rrvlpknpdkhleagcdllkqafaraailsnekfrgvrlyvsenqlkitannpeqeeaee
ildvtysgaemeigfnvsyvldvlnalkcenvrmmltdsvssvqiedaasqsaayvvmpm
rl

SCOP Domain Coordinates for d1unnb3:

Click to download the PDB-style file with coordinates for d1unnb3.
(The format of our PDB-style files is described here.)

Timeline for d1unnb3: