Lineage for d1un9a2 (1un9 A:1-170)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 392946Fold c.32: Tubulin/Dihydroxyacetone kinase nucleotide-binding domain [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 392947Superfamily c.32.1: Tubulin/Dihydroxyacetone kinase nucleotide-binding domain [52490] (2 families) (S)
  5. 392973Family c.32.1.2: Dihydroxyacetone kinase ATPase domain [89640] (2 proteins)
  6. 392974Protein Dihydroxyacetone kinase [102296] (1 species)
    contains additional alpha-helical, ATP-binding domain
  7. 392975Species Citrobacter freundii [TaxId:546] [102297] (2 PDB entries)
  8. 392978Domain d1un9a2: 1un9 A:1-170 [99668]
    Other proteins in same PDB: d1un9a1, d1un9a3, d1un9b1, d1un9b3

Details for d1un9a2

PDB Entry: 1un9 (more details), 3.1 Å

PDB Description: crystal structure of the dihydroxyacetone kinase from c. freundii in complex with amp-pnp and mg2+

SCOP Domain Sequences for d1un9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1un9a2 c.32.1.2 (A:1-170) Dihydroxyacetone kinase {Citrobacter freundii}
asqfffnqrthlvsdvidgaiiaspwnnlarlesdpairivvrrdlnknnvavisgggsg
hepahvgfigkgmltaavcgdvfaspsvdavltaiqavtgeagcllivknytgdrlnfgl
aaekarrlgynvemlivgddislpdnkhprgiagtilvhkiagyfaergy

SCOP Domain Coordinates for d1un9a2:

Click to download the PDB-style file with coordinates for d1un9a2.
(The format of our PDB-style files is described here.)

Timeline for d1un9a2: