Lineage for d1un8b2 (1un8 B:1-170)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 392946Fold c.32: Tubulin/Dihydroxyacetone kinase nucleotide-binding domain [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 392947Superfamily c.32.1: Tubulin/Dihydroxyacetone kinase nucleotide-binding domain [52490] (2 families) (S)
  5. 392973Family c.32.1.2: Dihydroxyacetone kinase ATPase domain [89640] (2 proteins)
  6. 392974Protein Dihydroxyacetone kinase [102296] (1 species)
    contains additional alpha-helical, ATP-binding domain
  7. 392975Species Citrobacter freundii [TaxId:546] [102297] (2 PDB entries)
  8. 392977Domain d1un8b2: 1un8 B:1-170 [99665]
    Other proteins in same PDB: d1un8a1, d1un8a3, d1un8b1, d1un8b3
    complexed with myy

Details for d1un8b2

PDB Entry: 1un8 (more details), 2.5 Å

PDB Description: crystal structure of the dihydroxyacetone kinase of c. freundii (native form)

SCOP Domain Sequences for d1un8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1un8b2 c.32.1.2 (B:1-170) Dihydroxyacetone kinase {Citrobacter freundii}
msqfffnqrthlvsdvidgaiiaspwnnlarlesdpairivvrrdlnknnvavisgggsg
hepahvgfigkgmltaavcgdvfaspsvdavltaiqavtgeagcllivknytgdrlnfgl
aaekarrlgynvemlivgddislpdnkhprgiagtilvhkiagyfaergy

SCOP Domain Coordinates for d1un8b2:

Click to download the PDB-style file with coordinates for d1un8b2.
(The format of our PDB-style files is described here.)

Timeline for d1un8b2: