Lineage for d1un7b2 (1un7 B:58-358)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 816850Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 817102Family c.1.9.10: N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain [82261] (1 protein)
  6. 817103Protein N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain [82262] (3 species)
  7. 817104Species Bacillus subtilis [TaxId:1423] [102086] (1 PDB entry)
  8. 817106Domain d1un7b2: 1un7 B:58-358 [99660]
    Other proteins in same PDB: d1un7a1, d1un7b1
    complexed with 2pe, fe, glp

Details for d1un7b2

PDB Entry: 1un7 (more details), 2.05 Å

PDB Description: the 3-d structure of the n-acetylglucosamine-6-phosphate deacetylase, naga, from bacillus subtilis: a member of the urease superfamily
PDB Compounds: (B:) N-acetylglucosamine-6-phosphate deacetylase

SCOP Domain Sequences for d1un7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1un7b2 c.1.9.10 (B:58-358) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Bacillus subtilis [TaxId: 1423]}
gmidihihggygadtmdasfstldimssrlpeegttsflattitqehgnisqalvnarew
kaaeessllgaellgihlegpfvspkragaqpkewirpsdvelfkkwqqeagglikivtl
apeedqhfelirhlkdesiiasmghtdadsallsdaakagashmthlynamspfhhrepg
vigtalahdgfvteliadgihshplaaklaflakgssklilitdsmrakglkdgvyefgg
qsvtvrgrtallsdgtlagsilkmnegarhmreftncswtdianitsenaakqlgifdrk
g

SCOP Domain Coordinates for d1un7b2:

Click to download the PDB-style file with coordinates for d1un7b2.
(The format of our PDB-style files is described here.)

Timeline for d1un7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1un7b1