SCOP 1.71: Domain d1un7b2: 1un7 B:58-358

Lineage for d1un7b2 (1un7 B:58-358)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.10: N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain [82261] (1 protein)

6. Protein N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain [82262] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [102086] (1 PDB entry)

8. Domain d1un7b2: 1un7 B:58-358 [99660]
   Other proteins in same PDB: d1un7a1, d1un7b1
   complexed with 2pe, fe, glp

Details for d1un7b2

PDB Entry: 1un7, 2.05 Å

PDB Description: the 3-d structure of the n-acetylglucosamine-6-phosphate deacetylase, naga, from bacillus subtilis: a member of the urease superfamily

SCOP Domain Sequences for d1un7b2:

Sequence; same for both SEQRES and ATOM records:

>d1un7b2 c.1.9.10 (B:58-358) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Bacillus subtilis}
gmidihihggygadtmdasfstldimssrlpeegttsflattitqehgnisqalvnarew
kaaeessllgaellgihlegpfvspkragaqpkewirpsdvelfkkwqqeagglikivtl
apeedqhfelirhlkdesiiasmghtdadsallsdaakagashmthlynamspfhhrepg
vigtalahdgfvteliadgihshplaaklaflakgssklilitdsmrakglkdgvyefgg
qsvtvrgrtallsdgtlagsilkmnegarhmreftncswtdianitsenaakqlgifdrk
g

Timeline for d1un7b2:

• d1un7b2 first appeared in SCOP 1.67
  
• d1un7b2 appears in SCOP 1.69
  
• d1un7b2 appears in SCOP 1.73
  
• d1un7b2 last appears in SCOP 1.75