Class b: All beta proteins [48724] (144 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.5: N-acetylglucosamine-6-phosphate deacetylase, NagA [82227] (1 protein) |
Protein N-acetylglucosamine-6-phosphate deacetylase, NagA [82228] (2 species) |
Species Bacillus subtilis [TaxId:1423] [102019] (1 PDB entry) |
Domain d1un7b1: 1un7 B:3-57,B:359-394 [99659] Other proteins in same PDB: d1un7a2, d1un7b2 |
PDB Entry: 1un7 (more details), 2.05 Å
SCOP Domain Sequences for d1un7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1un7b1 b.92.1.5 (B:3-57,B:359-394) N-acetylglucosamine-6-phosphate deacetylase, NagA {Bacillus subtilis} esllikdiaivtenevikngyvgindgkistvsterpkepyskeiqapadsvllpXsvtv gkdadlvivssdcevilticrgniafiskead
Timeline for d1un7b1: