Lineage for d1un7a2 (1un7 A:58-358)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 385405Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 385562Family c.1.9.10: N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain [82261] (1 protein)
  6. 385563Protein N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain [82262] (2 species)
  7. 385564Species Bacillus subtilis [TaxId:1423] [102086] (1 PDB entry)
  8. 385565Domain d1un7a2: 1un7 A:58-358 [99658]
    Other proteins in same PDB: d1un7a1, d1un7b1

Details for d1un7a2

PDB Entry: 1un7 (more details), 2.05 Å

PDB Description: the 3-d structure of the n-acetylglucosamine-6-phosphate deacetylase, naga, from bacillus subtilis: a member of the urease superfamily

SCOP Domain Sequences for d1un7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1un7a2 c.1.9.10 (A:58-358) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Bacillus subtilis}
gmidihihggygadtmdasfstldimssrlpeegttsflattitqehgnisqalvnarew
kaaeessllgaellgihlegpfvspkragaqpkewirpsdvelfkkwqqeagglikivtl
apeedqhfelirhlkdesiiasmghtdadsallsdaakagashmthlynamspfhhrepg
vigtalahdgfvteliadgihshplaaklaflakgssklilitdsmrakglkdgvyefgg
qsvtvrgrtallsdgtlagsilkmnegarhmreftncswtdianitsenaakqlgifdrk
g

SCOP Domain Coordinates for d1un7a2:

Click to download the PDB-style file with coordinates for d1un7a2.
(The format of our PDB-style files is described here.)

Timeline for d1un7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1un7a1