SCOP 1.71: Domain d1un7a1: 1un7 A:3-57,A:359-394

Lineage for d1un7a1 (1un7 A:3-57,A:359-394)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.5: N-acetylglucosamine-6-phosphate deacetylase, NagA [82227] (1 protein)

6. Protein N-acetylglucosamine-6-phosphate deacetylase, NagA [82228] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [102019] (1 PDB entry)

8. Domain d1un7a1: 1un7 A:3-57,A:359-394 [99657]
   Other proteins in same PDB: d1un7a2, d1un7b2

Details for d1un7a1

PDB Entry: 1un7, 2.05 Å

PDB Description: the 3-d structure of the n-acetylglucosamine-6-phosphate deacetylase, naga, from bacillus subtilis: a member of the urease superfamily

SCOP Domain Sequences for d1un7a1:

Sequence; same for both SEQRES and ATOM records:

>d1un7a1 b.92.1.5 (A:3-57,A:359-394) N-acetylglucosamine-6-phosphate deacetylase, NagA {Bacillus subtilis}
esllikdiaivtenevikngyvgindgkistvsterpkepyskeiqapadsvllpXsvtv
gkdadlvivssdcevilticrgniafiskead

Timeline for d1un7a1:

• d1un7a1 first appeared in SCOP 1.67
  
• d1un7a1 appears in SCOP 1.69
  
• d1un7a1 appears in SCOP 1.73
  
• d1un7a1 last appears in SCOP 1.75