Lineage for d1umnh_ (1umn H:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441060Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 441061Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 441062Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 441196Protein Dodecameric ferritin homolog [47250] (10 species)
  7. 441367Species Streptococcus suis [101134] (1 PDB entry)
  8. 441375Domain d1umnh_: 1umn H: [99614]

Details for d1umnh_

PDB Entry: 1umn (more details), 1.95 Å

PDB Description: crystal structure of dps-like peroxide resistance protein (dpr) from streptococcus suis

SCOP Domain Sequences for d1umnh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umnh_ a.25.1.1 (H:) Dodecameric ferritin homolog {Streptococcus suis}
ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
svtndifnvakasiekhiwmlqaelgqapkl

SCOP Domain Coordinates for d1umnh_:

Click to download the PDB-style file with coordinates for d1umnh_.
(The format of our PDB-style files is described here.)

Timeline for d1umnh_: