Lineage for d1umng_ (1umn G:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 638520Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 638728Protein Dodecameric ferritin homolog [47250] (13 species)
  7. 638979Species Streptococcus suis [TaxId:1307] [101134] (2 PDB entries)
  8. 638986Domain d1umng_: 1umn G: [99613]

Details for d1umng_

PDB Entry: 1umn (more details), 1.95 Å

PDB Description: crystal structure of dps-like peroxide resistance protein (dpr) from streptococcus suis
PDB Compounds: (G:) dps-like peroxide resistance protein

SCOP Domain Sequences for d1umng_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umng_ a.25.1.1 (G:) Dodecameric ferritin homolog {Streptococcus suis [TaxId: 1307]}
qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl

SCOP Domain Coordinates for d1umng_:

Click to download the PDB-style file with coordinates for d1umng_.
(The format of our PDB-style files is described here.)

Timeline for d1umng_: