Lineage for d1umna_ (1umn A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536008Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 536009Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 536010Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 536144Protein Dodecameric ferritin homolog [47250] (10 species)
  7. 536331Species Streptococcus suis [101134] (1 PDB entry)
  8. 536332Domain d1umna_: 1umn A: [99607]

Details for d1umna_

PDB Entry: 1umn (more details), 1.95 Å

PDB Description: crystal structure of dps-like peroxide resistance protein (dpr) from streptococcus suis

SCOP Domain Sequences for d1umna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umna_ a.25.1.1 (A:) Dodecameric ferritin homolog {Streptococcus suis}
ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
svtndifnvakasiekhiwmlqaelgqapkl

SCOP Domain Coordinates for d1umna_:

Click to download the PDB-style file with coordinates for d1umna_.
(The format of our PDB-style files is described here.)

Timeline for d1umna_: