SCOP 1.73: Domain d1umdd2: 1umd D:188-324

Lineage for d1umdd2 (1umd D:188-324)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families)

5. Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins)

6. Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species)

7. Species Thermus thermophilus [TaxId:274] [102468] (4 PDB entries)

8. Domain d1umdd2: 1umd D:188-324 [99604]
   Other proteins in same PDB: d1umda_, d1umdb1, d1umdc_, d1umdd1
   complexed with coi, mg, tdp

Details for d1umdd2

PDB Entry: 1umd, 1.9 Å

PDB Description: branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate

PDB Compounds: (D:) 2-oxo acid dehydrogenase beta subunit

SCOP Domain Sequences for d1umdd2:

Sequence; same for both SEQRES and ATOM records:

>d1umdd2 c.48.1.2 (D:188-324) Branched-chain alpha-keto acid dehydrogenase {Thermus thermophilus [TaxId: 274]}
dytlpigkaalrregkdltlicygtvmpevlqaaaelakagvsaevldlrtlmpwdyeav
mnsvaktgrvvlvsdaprhasfvsevaatiaedlldmllappirvtgfdtpypyaqdkly
lptvtrilnaakraldy

Timeline for d1umdd2:

• d1umdd2 first appeared in SCOP 1.67
  
• d1umdd2 appears in SCOP 1.71
  
• d1umdd2 appears in SCOP 1.75
  
• d1umdd2 appears in the current release, SCOPe 2.08