Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) |
Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins) automatically mapped to Pfam PF02780 |
Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species) |
Species Thermus thermophilus [TaxId:274] [102468] (4 PDB entries) |
Domain d1umdb2: 1umd B:188-324 [99601] Other proteins in same PDB: d1umda_, d1umdb1, d1umdc_, d1umdd1 complexed with coi, mg, tdp |
PDB Entry: 1umd (more details), 1.9 Å
SCOPe Domain Sequences for d1umdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1umdb2 c.48.1.2 (B:188-324) Branched-chain alpha-keto acid dehydrogenase {Thermus thermophilus [TaxId: 274]} dytlpigkaalrregkdltlicygtvmpevlqaaaelakagvsaevldlrtlmpwdyeav mnsvaktgrvvlvsdaprhasfvsevaatiaedlldmllappirvtgfdtpypyaqdkly lptvtrilnaakraldy
Timeline for d1umdb2:
View in 3D Domains from other chains: (mouse over for more information) d1umda_, d1umdc_, d1umdd1, d1umdd2 |