Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Glucodextranase, domain B [101525] (1 species) |
Species Arthrobacter globiformis [TaxId:1665] [101526] (2 PDB entries) |
Domain d1ulva2: 1ulv A:687-775 [99572] Other proteins in same PDB: d1ulva1, d1ulva3, d1ulva4 complexed with ca |
PDB Entry: 1ulv (more details), 2.42 Å
SCOPe Domain Sequences for d1ulva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ulva2 b.1.18.2 (A:687-775) Glucodextranase, domain B {Arthrobacter globiformis [TaxId: 1665]} tplsspelsvtapealstadsatavvrgttnaakvyvsvngtateapvtdgtfsldvalt gaknkvtvaavaadggtavedrtvlyygs
Timeline for d1ulva2: