Lineage for d1uksb1 (1uks B:496-581)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 367734Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 367808Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (16 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 367838Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. 367839Species Bacillus circulans, different strains [TaxId:1397] [49216] (36 PDB entries)
  8. 367844Domain d1uksb1: 1uks B:496-581 [99521]
    Other proteins in same PDB: d1uksa2, d1uksa3, d1uksa4, d1uksb2, d1uksb3, d1uksb4
    complexed with aci, ca, glb, glc, gld; mutant

Details for d1uksb1

PDB Entry: 1uks (more details), 1.9 Å

PDB Description: crystal structure of f183l/f259l mutant cyclodextrin glucanotransferase complexed with a pseudo-maltotetraose derived from acarbose

SCOP Domain Sequences for d1uksb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uksb1 b.1.18.2 (B:496-581) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains}
attpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgadivawedtqiqvkipa
vpggiydirvanaagaasniydnfev

SCOP Domain Coordinates for d1uksb1:

Click to download the PDB-style file with coordinates for d1uksb1.
(The format of our PDB-style files is described here.)

Timeline for d1uksb1: