Class b: All beta proteins [48724] (149 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (2 families) |
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) |
Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) this domain is the last one in the protein chain |
Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries) |
Domain d1uksa2: 1uks A:582-686 [99518] Other proteins in same PDB: d1uksa1, d1uksa3, d1uksa4, d1uksb1, d1uksb3, d1uksb4 |
PDB Entry: 1uks (more details), 1.9 Å
SCOP Domain Sequences for d1uksa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uksa2 b.3.1.1 (A:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains} ltgdqvtvrfvinnattalgqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvs vpagqtiefkflkkqgstvtwegganrtfttptsgtatvnvnwqp
Timeline for d1uksa2:
View in 3D Domains from other chains: (mouse over for more information) d1uksb1, d1uksb2, d1uksb3, d1uksb4 |