Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Cyclodextrin glycosyltransferase [51452] (5 species) contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like |
Species Bacillus circulans, different strains [TaxId:1397] [51453] (36 PDB entries) |
Domain d1ukqb4: 1ukq B:1-406 [99516] Other proteins in same PDB: d1ukqa1, d1ukqa2, d1ukqa3, d1ukqb1, d1ukqb2, d1ukqb3 complexed with aci, ca, glc has additional subdomain(s) that are not in the common domain |
PDB Entry: 1ukq (more details), 2 Å
SCOPe Domain Sequences for d1ukqb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ukqb4 c.1.8.1 (B:1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]} apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk sfmatinnykpvftfgewflgvneispeyhqfanesgmslldfrfaqkarqvfrdntdnm yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiay
Timeline for d1ukqb4:
View in 3D Domains from other chains: (mouse over for more information) d1ukqa1, d1ukqa2, d1ukqa3, d1ukqa4 |