Lineage for d1ukqb2 (1ukq B:582-686)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457077Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 457078Superfamily b.3.1: Starch-binding domain-like [49452] (2 families) (S)
  5. 457079Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 457111Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 457112Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)
  8. 457126Domain d1ukqb2: 1ukq B:582-686 [99514]
    Other proteins in same PDB: d1ukqa1, d1ukqa3, d1ukqa4, d1ukqb1, d1ukqb3, d1ukqb4

Details for d1ukqb2

PDB Entry: 1ukq (more details), 2 Å

PDB Description: crystal structure of cyclodextrin glucanotransferase complexed with a pseudo-maltotetraose derived from acarbose

SCOP Domain Sequences for d1ukqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ukqb2 b.3.1.1 (B:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
ltgdqvtvrfvinnattalgqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvs
vpagqtiefkflkkqgstvtwegganrtfttptsgtatvnvnwqp

SCOP Domain Coordinates for d1ukqb2:

Click to download the PDB-style file with coordinates for d1ukqb2.
(The format of our PDB-style files is described here.)

Timeline for d1ukqb2: