![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein beta-Amylase [51481] (3 species) Common fold covers whole protein structure |
![]() | Species Soybean (Glycine max) [TaxId:3847] [51482] (18 PDB entries) Uniprot P10538 |
![]() | Domain d1ukpa_: 1ukp A: [99505] complexed with so4; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ukp (more details), 2.1 Å
SCOPe Domain Sequences for d1ukpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ukpa_ c.1.8.1 (A:) beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} nmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielkgpk qydwrayrsllqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdifytn rsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievglgpag elrypsypqsqgwefpgigefqcydkylkadfkaavaraghpewelpddagkyndvpest gffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihwwykv enhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpqelvqq vlsggwreyirvagenalprydataynqiilnarpqgvnnngppklsmfgvtylrlsddl lqksnfnifkkfvlkmhadqdycanpqkynhaitplspsapkipievlleatkptrpfpw ldetdmkvdg
Timeline for d1ukpa_: