SCOP 1.67: Domain d1uiva_: 1uiv A:

Lineage for d1uiva_ (1uiv A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (26 proteins)

6. Protein Nickel-binding periplasmic protein NikA [102694] (1 species)
   similar domain organization to oligo- and dipeptide-binding protein

7. Species Escherichia coli [TaxId:562] [102695] (2 PDB entries)

8. Domain d1uiva_: 1uiv A: [99436]

Details for d1uiva_

PDB Entry: 1uiv, 1.95 Å

PDB Description: crystal structures of the liganded and unliganded nickel binding protein nika from escherichia coli (nickel liganded form)

SCOP Domain Sequences for d1uiva_:

Sequence; same for both SEQRES and ATOM records:

>d1uiva_ c.94.1.1 (A:) Nickel-binding periplasmic protein NikA {Escherichia coli}
deittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgktw
tftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitlk
sayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrnen
ywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtqls
qpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyanl
glkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiirad
mrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaqq
gladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgni
pyapiateipfeqikpv

Timeline for d1uiva_:

• d1uiva_ is new in SCOP 1.67
  
• d1uiva_ appears in SCOP 1.69
  
• d1uiva_ appears in the current release, SCOPe 2.08