Lineage for d1uimb_ (1uim B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907393Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2907561Protein Threonine synthase [64172] (4 species)
  7. 2907578Species Thermus thermophilus [TaxId:274] [102667] (6 PDB entries)
  8. 2907592Domain d1uimb_: 1uim B: [99426]
    complexed with plp

Details for d1uimb_

PDB Entry: 1uim (more details), 2.15 Å

PDB Description: Crystal Structure of Threonine Synthase from Thermus Thermophilus HB8, Orthorhombic Crystal Form
PDB Compounds: (B:) threonine synthase

SCOPe Domain Sequences for d1uimb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uimb_ c.79.1.1 (B:) Threonine synthase {Thermus thermophilus [TaxId: 274]}
mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
lregrlepestvvltltghglkdpataervaelpppvparleavaaaagl

SCOPe Domain Coordinates for d1uimb_:

Click to download the PDB-style file with coordinates for d1uimb_.
(The format of our PDB-style files is described here.)

Timeline for d1uimb_: