Lineage for d1ui7b3 (1ui7 B:97-211)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180921Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2181140Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 2181141Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 2181142Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 2181143Species Arthrobacter globiformis [TaxId:1665] [54421] (40 PDB entries)
    Uniprot P46881 9-628
  8. 2181251Domain d1ui7b3: 1ui7 B:97-211 [99418]
    Other proteins in same PDB: d1ui7a1, d1ui7b1
    complexed with cu

Details for d1ui7b3

PDB Entry: 1ui7 (more details), 2 Å

PDB Description: site-directed mutagenesis of his433 involved in binding of copper ion in arthrobacter globiformis amine oxidase
PDB Compounds: (B:) phenylethylamine oxidase

SCOPe Domain Sequences for d1ui7b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ui7b3 d.17.2.1 (B:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

SCOPe Domain Coordinates for d1ui7b3:

Click to download the PDB-style file with coordinates for d1ui7b3.
(The format of our PDB-style files is described here.)

Timeline for d1ui7b3: