Lineage for d1ui7a1 (1ui7 A:212-628)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781475Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 2781476Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins)
  6. 2781477Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 2781478Species Arthrobacter globiformis [TaxId:1665] [50003] (41 PDB entries)
    Uniprot P46881 9-628
  8. 2781520Domain d1ui7a1: 1ui7 A:212-628 [99413]
    Other proteins in same PDB: d1ui7a2, d1ui7a3, d1ui7b2, d1ui7b3
    complexed with cu

Details for d1ui7a1

PDB Entry: 1ui7 (more details), 2 Å

PDB Description: site-directed mutagenesis of his433 involved in binding of copper ion in arthrobacter globiformis amine oxidase
PDB Compounds: (A:) phenylethylamine oxidase

SCOPe Domain Sequences for d1ui7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ui7a1 b.30.2.1 (A:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignydygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqaifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan

SCOPe Domain Coordinates for d1ui7a1:

Click to download the PDB-style file with coordinates for d1ui7a1.
(The format of our PDB-style files is described here.)

Timeline for d1ui7a1: