Lineage for d1uhvd1 (1uhv D:1-13,D:360-500)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566044Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 566045Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 566344Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
    interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain
  6. 566355Protein Beta-D-xylosidase [101926] (1 species)
    glycosyl hydrolase family 39
  7. 566356Species Thermoanaerobacterium saccharolyticum [TaxId:28896] [101927] (2 PDB entries)
  8. 566360Domain d1uhvd1: 1uhv D:1-13,D:360-500 [99408]
    Other proteins in same PDB: d1uhva2, d1uhvb2, d1uhvc2, d1uhvd2
    complexed with dfx

Details for d1uhvd1

PDB Entry: 1uhv (more details), 2.1 Å

PDB Description: crystal structure of beta-d-xylosidase from thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase

SCOP Domain Sequences for d1uhvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhvd1 b.71.1.2 (D:1-13,D:360-500) Beta-D-xylosidase {Thermoanaerobacterium saccharolyticum}
mikvrvpdfsdkkXemlyrdehmlvtrrddgsvaliawnevmdktenpdedyeveipvrf
rdvfikrqlideehgnpwgtwihmgrprypskeqvntlrevakpeimtsqpvandgylnl
kfklgknavvlyelteridesstyiglddskingy

SCOP Domain Coordinates for d1uhvd1:

Click to download the PDB-style file with coordinates for d1uhvd1.
(The format of our PDB-style files is described here.)

Timeline for d1uhvd1: