Class b: All beta proteins [48724] (144 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins) interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain |
Protein Beta-D-xylosidase [101926] (1 species) glycosyl hydrolase family 39 |
Species Thermoanaerobacterium saccharolyticum [TaxId:28896] [101927] (2 PDB entries) |
Domain d1uhvd1: 1uhv D:1-13,D:360-500 [99408] Other proteins in same PDB: d1uhva2, d1uhvb2, d1uhvc2, d1uhvd2 |
PDB Entry: 1uhv (more details), 2.1 Å
SCOP Domain Sequences for d1uhvd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uhvd1 b.71.1.2 (D:1-13,D:360-500) Beta-D-xylosidase {Thermoanaerobacterium saccharolyticum} mikvrvpdfsdkkXemlyrdehmlvtrrddgsvaliawnevmdktenpdedyeveipvrf rdvfikrqlideehgnpwgtwihmgrprypskeqvntlrevakpeimtsqpvandgylnl kfklgknavvlyelteridesstyiglddskingy
Timeline for d1uhvd1: