SCOP 1.73: Domain d1uhvc1: 1uhv C:1-13,C:360-500

Lineage for d1uhvc1 (1uhv C:1-13,C:360-500)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
   interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain

6. Protein Beta-D-xylosidase [101926] (2 species)
   glycosyl hydrolase family 39

7. Species Thermoanaerobacterium saccharolyticum [TaxId:28896] [101927] (2 PDB entries)

8. Domain d1uhvc1: 1uhv C:1-13,C:360-500 [99406]
   Other proteins in same PDB: d1uhva2, d1uhvb2, d1uhvc2, d1uhvd2

Details for d1uhvc1

PDB Entry: 1uhv, 2.1 Å

PDB Description: crystal structure of beta-d-xylosidase from thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase

PDB Compounds: (C:) beta-xylosidase

SCOP Domain Sequences for d1uhvc1:

Sequence; same for both SEQRES and ATOM records:

>d1uhvc1 b.71.1.2 (C:1-13,C:360-500) Beta-D-xylosidase {Thermoanaerobacterium saccharolyticum [TaxId: 28896]}
mikvrvpdfsdkkXemlyrdehmlvtrrddgsvaliawnevmdktenpdedyeveipvrf
rdvfikrqlideehgnpwgtwihmgrprypskeqvntlrevakpeimtsqpvandgylnl
kfklgknavvlyelteridesstyiglddskingy

Timeline for d1uhvc1:

• d1uhvc1 first appeared in SCOP 1.67
  
• d1uhvc1 appears in SCOP 1.71
  
• d1uhvc1 appears in SCOP 1.75
  
• d1uhvc1 appears in the current release, SCOPe 2.08