Lineage for d1uhva2 (1uhv A:14-359)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 384721Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 384751Protein Beta-D-xylosidase, catalytic domain [102077] (1 species)
    glycosyl hydrolase family 39
  7. 384752Species Thermoanaerobacterium saccharolyticum [TaxId:28896] [102078] (2 PDB entries)
  8. 384753Domain d1uhva2: 1uhv A:14-359 [99403]
    Other proteins in same PDB: d1uhva1, d1uhvb1, d1uhvc1, d1uhvd1

Details for d1uhva2

PDB Entry: 1uhv (more details), 2.1 Å

PDB Description: crystal structure of beta-d-xylosidase from thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase

SCOP Domain Sequences for d1uhva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum}
fsdrwrycvgtgrlglalqkeyietlkyvkenidfkyirghgllcddvgiyredvvgdev
kpfynftyidrifdsfleigirpfveigfmpkklasgtqtvfywegnvtppkdyekwsdl
vkavlhhfisrygieevlkwpfeiwnepnlkefwkdadekeyfklykvtakaikevnenl
kvggpaicggadywiedflnfcyeenvpvdfvsrhaytskqgeytphliyqeimpseyml
nefktvreiiknshfpnlpfhiteyntsyspqnpvhdtpfnaayiarilseggdyvdsfs
ywtfsdvfeerdvprsqfhggfglvalnmipkptfytfkffnamge

SCOP Domain Coordinates for d1uhva2:

Click to download the PDB-style file with coordinates for d1uhva2.
(The format of our PDB-style files is described here.)

Timeline for d1uhva2: