Lineage for d1ug9a3 (1ug9 A:776-1020)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764503Superfamily b.1.9: CBD9-like [49344] (4 families) (S)
    has additional strand at N-terminus; the active site in a similar topological location as the Cu,Zn SOD site
  5. 2764521Family b.1.9.3: Glucodextranase, domain C [101533] (1 protein)
    automatically mapped to Pfam PF09985
  6. 2764522Protein Glucodextranase, domain C [101534] (1 species)
  7. 2764523Species Arthrobacter globiformis [TaxId:1665] [101535] (2 PDB entries)
  8. 2764524Domain d1ug9a3: 1ug9 A:776-1020 [99363]
    Other proteins in same PDB: d1ug9a1, d1ug9a2, d1ug9a4
    complexed with ca, gol

Details for d1ug9a3

PDB Entry: 1ug9 (more details), 2.5 Å

PDB Description: Crystal Structure of Glucodextranase from Arthrobacter globiformis I42
PDB Compounds: (A:) glucodextranase

SCOPe Domain Sequences for d1ug9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ug9a3 b.1.9.3 (A:776-1020) Glucodextranase, domain C {Arthrobacter globiformis [TaxId: 1665]}
rigalsdpagddngpgtyryptnsayvpgafdltgvdvydagddyafvatiagevtnpwg
gqaishqrvniylgkgeggatpglpgtninlehawdsvivtdgrfdgagvyapdgtrtsa
vsllavpearqivtrvpkaalggldpatarmsvamfgnaesgegignvrpvydgayweag
dpawikewrfgggagvfdgtipsrdtdtddpnaldvlvgegqtqaavldwragspvvvpm
lglqp

SCOPe Domain Coordinates for d1ug9a3:

Click to download the PDB-style file with coordinates for d1ug9a3.
(The format of our PDB-style files is described here.)

Timeline for d1ug9a3: