Lineage for d1ueva3 (1uev A:258-437)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412771Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (2 families) (S)
  5. 412779Family d.58.16.2: Archaeal tRNA CCA-adding enzyme [102995] (1 protein)
    decorated fold with a large insertion
  6. 412780Protein tRNA nucleotidyltransferase, C-terminal domain [102996] (1 species)
  7. 412781Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102997] (7 PDB entries)
  8. 412788Domain d1ueva3: 1uev A:258-437 [99280]
    Other proteins in same PDB: d1ueva1, d1ueva2
    complexed with atp, ca, mg

Details for d1ueva3

PDB Entry: 1uev (more details), 2.7 Å

PDB Description: Divergent evolutions of trinucleotide polymerization revealed by an archaeal CCA-adding enzyme structure

SCOP Domain Sequences for d1ueva3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ueva3 d.58.16.2 (A:258-437) tRNA nucleotidyltransferase, C-terminal domain {Archaeon Archaeoglobus fulgidus}
hpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifeflerenfmplr
safkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpfiengrwwaf
emrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtaelcemmgvkd

SCOP Domain Coordinates for d1ueva3:

Click to download the PDB-style file with coordinates for d1ueva3.
(The format of our PDB-style files is described here.)

Timeline for d1ueva3: