Lineage for d1uela_ (1uel A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1194675Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1194676Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1195050Protein Ubiquitin-like domain of Rad23 homolog B (Hhr23B) [102777] (1 species)
  7. 1195051Species Human (Homo sapiens) [TaxId:9606] [102778] (2 PDB entries)
    Uniprot P54727 1-82
  8. 1195052Domain d1uela_: 1uel A: [99265]
    Other proteins in same PDB: d1uelb_
    complexed with the C-terminal ubiquitin-interacting motif of the proteasome subunit s5a

Details for d1uela_

PDB Entry: 1uel (more details)

PDB Description: Solution structure of ubiquitin-like domain of hHR23B complexed with ubiquitin-interacting motif of proteasome subunit S5a
PDB Compounds: (A:) UV excision repair protein RAD23 homolog B

SCOPe Domain Sequences for d1uela_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]}
mqvtlktlqqqtfkididpeetvkalkekiesekgkdafpvagqkliyagkilnddtalk
eykideknfvvvmvtkpkavstpapatlehhhhhh

SCOPe Domain Coordinates for d1uela_:

Click to download the PDB-style file with coordinates for d1uela_.
(The format of our PDB-style files is described here.)

Timeline for d1uela_: