![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (6 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (14 proteins) |
![]() | Protein Ubiquitin-like domain of Rad23 homolog B (Hhr23B) [102777] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102778] (1 PDB entry) |
![]() | Domain d1uela_: 1uel A: [99265] Other proteins in same PDB: d1uelb_ complexed with the C-terminal ubiquitin-interacting motif of the proteasome subunit s5a |
PDB Entry: 1uel (more details)
SCOP Domain Sequences for d1uela_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens)} mqvtlktlqqqtfkididpeetvkalkekiesekgkdafpvagqkliyagkilnddtalk eykideknfvvvmvtkpkavstpapatlehhhhhh
Timeline for d1uela_: