Lineage for d1udyc2 (1udy C:11-241)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 424231Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 424232Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 424233Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (5 proteins)
  6. 424253Protein Medium chain acyl-CoA dehydrogenase, NM domains [56649] (2 species)
  7. 424267Species Pig (Sus scrofa) [TaxId:9823] [56650] (3 PDB entries)
  8. 424274Domain d1udyc2: 1udy C:11-241 [99236]
    Other proteins in same PDB: d1udya1, d1udyb1, d1udyc1, d1udyd1

Details for d1udyc2

PDB Entry: 1udy (more details), 2.4 Å

PDB Description: Medium-Chain Acyl-CoA Dehydrogenase with 3-Thiaoctanoyl-CoA

SCOP Domain Sequences for d1udyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udyc2 e.6.1.1 (C:11-241) Medium chain acyl-CoA dehydrogenase, NM domains {Pig (Sus scrofa)}
gfsfelteqqkefqatarkfareeiipvaaeydrtgeypvpllkrawelglmnthipesf
gglglgiidscliteelaygctgvqtaieantlgqvpliiggnyqqqkkylgrmteeplm
caycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkapa
skaftgfiveadtpgvqigrkeinmgqrcsdtrgivfedvrvpkenvltge

SCOP Domain Coordinates for d1udyc2:

Click to download the PDB-style file with coordinates for d1udyc2.
(The format of our PDB-style files is described here.)

Timeline for d1udyc2: