Lineage for d1udyc1 (1udy C:242-395)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708345Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)
  6. 2708386Protein Medium chain acyl-CoA dehydrogenase, C-domain [47207] (3 species)
  7. 2708408Species Pig (Sus scrofa) [TaxId:9823] [47208] (3 PDB entries)
  8. 2708411Domain d1udyc1: 1udy C:242-395 [99235]
    Other proteins in same PDB: d1udya2, d1udyb2, d1udyc2, d1udyd2
    complexed with cs8, fad

Details for d1udyc1

PDB Entry: 1udy (more details), 2.4 Å

PDB Description: Medium-Chain Acyl-CoA Dehydrogenase with 3-Thiaoctanoyl-CoA
PDB Compounds: (C:) Acyl-CoA dehydrogenase, medium-chain specific

SCOPe Domain Sequences for d1udyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udyc1 a.29.3.1 (C:242-395) Medium chain acyl-CoA dehydrogenase, C-domain {Pig (Sus scrofa) [TaxId: 9823]}
gagfkiamgtfdktrppvaagavglaqraldeatkyalerktfgkllaehqgisflladm
amkvelarlsyqraaweidsgrrntyyasiakayaadianqlatdavqvfggngfnteyp
veklmrdakiyqiyegtaqiqriiiarehigryk

SCOPe Domain Coordinates for d1udyc1:

Click to download the PDB-style file with coordinates for d1udyc1.
(The format of our PDB-style files is described here.)

Timeline for d1udyc1: