SCOP 1.75: Domain d1udqa1: 1udq A:2-150

Lineage for d1udqa1 (1udq A:2-150)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins)

6. Protein Ribonuclease PH, domain 1 [102758] (3 species)

7. Species Aquifex aeolicus [TaxId:63363] [102759] (4 PDB entries)

8. Domain d1udqa1: 1udq A:2-150 [99217]
   Other proteins in same PDB: d1udqa2
   complexed with po4, so4; mutant

Details for d1udqa1

PDB Entry: 1udq, 2.3 Å

PDB Description: crystal structure of the trna processing enzyme rnase ph t125a mutant from aquifex aeolicus

PDB Compounds: (A:) Ribonuclease PH

SCOP Domain Sequences for d1udqa1:

Sequence; same for both SEQRES and ATOM records:

>d1udqa1 d.14.1.4 (A:2-150) Ribonuclease PH, domain 1 {Aquifex aeolicus [TaxId: 63363]}
rsdgrkedqlrpvsiqrdfleypegsclisfgktkvictasvienvpnwlkgkgqgwita
eysmlpratqqrtiresvqgriggrtheiqrmigramrtaveltkigertiwvdcdviqa
dggartaaitgafvavadaiiklhkegii

Timeline for d1udqa1:

• d1udqa1 first appeared in SCOP 1.67
  
• d1udqa1 appears in SCOP 1.73
  
• d1udqa1 appears in SCOPe 2.01
  
• d1udqa1 appears in the current release, SCOPe 2.08