Lineage for d1ucrb_ (1ucr B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762766Family a.4.5.45: Dissimilatory sulfite reductase DsvD [101048] (1 protein)
  6. 762767Protein Dissimilatory sulfite reductase DsvD [101049] (1 species)
  7. 762768Species Desulfovibrio vulgaris [TaxId:881] [101050] (2 PDB entries)
  8. 762770Domain d1ucrb_: 1ucr B: [99189]
    complexed with so4

Details for d1ucrb_

PDB Entry: 1ucr (more details), 1.2 Å

PDB Description: Three-dimensional crystal structure of dissimilatory sulfite reductase D (DsrD)
PDB Compounds: (B:) Protein dsvD

SCOP Domain Sequences for d1ucrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ucrb_ a.4.5.45 (B:) Dissimilatory sulfite reductase DsvD {Desulfovibrio vulgaris [TaxId: 881]}
meeakqkvvdflnsksgskskfyfndftdlfpdmkqrevkkiltalvndevleywssgst
tmyglkgagkqaaae

SCOP Domain Coordinates for d1ucrb_:

Click to download the PDB-style file with coordinates for d1ucrb_.
(The format of our PDB-style files is described here.)

Timeline for d1ucrb_: