SCOPe 2.08: Domain d1ub6h1: 1ub6 H:2-116

Lineage for d1ub6h1 (1ub6 H:2-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (15 PDB entries)
   Uniprot P18527 # HV56_MOUSE Ig heavy chain V region 914; 90% sequence identity

8. Domain d1ub6h1: 1ub6 H:2-116 [99155]
   Other proteins in same PDB: d1ub6a2, d1ub6b1, d1ub6b2, d1ub6h2, d1ub6l1, d1ub6l2
   part of blue fluorescent Fab 19G2

Details for d1ub6h1

PDB Entry: 1ub6, 2.12 Å

PDB Description: Crystal structure of Antibody 19G2 with sera ligand

PDB Compounds: (H:) antibody 19G2, alpha chain

SCOPe Domain Sequences for d1ub6h1:

Sequence; same for both SEQRES and ATOM records:

>d1ub6h1 b.1.1.1 (H:2-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]}
aallesggglvkpggslklsctasgitfsryimswvrqipekrlewvasissggityypd
svagrftisrdnvrnilylqmsslrsedtalyycargqgrpywgqgtlvtvsa

Timeline for d1ub6h1:

• d1ub6h1 first appeared in SCOP 1.67
  
• d1ub6h1 appears in SCOPe 2.07