Lineage for d1ub6b2 (1ub6 B:114-214)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1761687Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1761919Species Mouse (Mus musculus) [TaxId:10090] [88567] (346 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 1762104Domain d1ub6b2: 1ub6 B:114-214 [99154]
    Other proteins in same PDB: d1ub6a1, d1ub6a2, d1ub6b1, d1ub6h1, d1ub6h2, d1ub6l1
    part of blue fluorescent Fab 19G2

Details for d1ub6b2

PDB Entry: 1ub6 (more details), 2.12 Å

PDB Description: Crystal structure of Antibody 19G2 with sera ligand
PDB Compounds: (B:) antibody 19G2, beta chain

SCOPe Domain Sequences for d1ub6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ub6b2 b.1.1.2 (B:114-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhngytceathktstspivksf

SCOPe Domain Coordinates for d1ub6b2:

Click to download the PDB-style file with coordinates for d1ub6b2.
(The format of our PDB-style files is described here.)

Timeline for d1ub6b2: